| [KO Validated] NRF2 Rabbit mAb | |
| Purification | Affinity purification |
| Isotype | IgG |
| CloneNo | ARC0806 |
| Immunogen | Synthetic peptide. This information is considered to be commercially sensitive. |
| Sequence | GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN |
| Gene ID | 4780 |
| Swiss prot | Q16236 |
| Synonyms | NRF2; HEBP1; Nrf-2; IMDDHH; F2 |
| Calculated MW | 68kDa |
| Observed MW | 103kDa/97-100 kDa |
| Recommended dilution | WB 1:1000 - 1:2000, IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells, ChIP 5μg antibody for 5μg-10μg of Chromatin, ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. |
| Storage | Store at -20℃. Avoid freeze / thaw cycles. |
| Buffer | Buffer: PBS containing 50% glycerol and 0.05% BSA, preserved with proclin300 or sodium azide (as specified on the Certificate of Analysis), pH 7.3. |
| Cellular location | centrosome, cytoplasm, cytosol, Golgi apparatus, nucleoplasm, nucleus, plasma membrane |
| Positive samples | HeLa, C6 treated with MG132 |
| Background | This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene. |
| Validated Image |
Western blot analysis of lysates from C6 cells using [KO Validated] NRF2 Rabbit mAb (A3577) at 1:1000 dilution incubated overnight at 4℃. C6 cells were treated with MG132 (10 μM) at 37℃ for 90 minutes 
Western blot analysis of extracts from wild type(WT) and NRF2 knockout (KO) HeLa cells, using [KO Validated] NRF2 Rabbit mAb (A3577) at 1:1000 dilution 
Chromatin immunoprecipitation was performed with cross-linked chromatin from HepG2 cells, using Nrf2 Rabbit mAb (A3577) and rabbit IgG (AC042). The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram compares the ratio of the immunoprecipitated DNA versus the input. |
[KO Validated] NRF2 Rabbit mAb
| Catalogue No | BSAB-302P |
| Host | Rabbit |
| Reactivity | Human, Rat |
| Applications | WB, IP, ChIP, ELISA |
| Size | 20μL | 100μL |
| Price | POR |